An official website of the United States government.

Official websites use .gov
A .gov website belongs to an official government organization in the United States.

Secure .gov websites use HTTPS
A lock ( ) or https:// means you've safely connected to the .gov website. Share sensitive information only on official, secure websites.

National Agricultural Library
U.S. Department of Agriculture
  1. Home
  2. Human Nutrition and Food Safety
  3. Research Publications (Food Safety)

Research Publications (Food Safety)

This page tracks research articles published in national and international peer-reviewed journals. Recent articles are available ahead of print and searchable by Journal, Article Title, and Category. Research publications are tracked across six categories: Bacterial Pathogens, Chemical Contaminants, Natural Toxins, Parasites, Produce Safety, and Viruses. Articles produced by USDA Grant Funding Agencies (requires login) and FDA Grant Funding Agencies (requires login) are also tracked in Scopus.

Displaying 1 - 5 of 5

  1. A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits Listeria monocytogenes and Extends the Shelf Life of Beef in Combination with Chitosan

    • Journal of Agricultural and Food Chemistry

    • Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L.

      • Bacterial pathogens
      • Listeria monocytogenes

  2. A Novel Class IIb Bacteriocin-Plantaricin EmF Effectively Inhibits Listeria monocytogenes and Extends the Shelf Life of Beef in Combination with Chitosan

    • Journal of Agricultural and Food Chemistry

    • Plantaricin EmF separated and identified from L. plantarum 163 was a novel class IIb bacteriocin. The molecular masses of plantaricin Em and F were 1638 and 3702 Da, respectively, with amino acid sequences FNRGGYNFGKSVRH and VFHAYSARGVRNNYKSAVGPADWVISAVRGFIHG, respectively. Plantaricin EmF not only exhibited broad-pH adaptability and thermostability but also showed high efficiency and broad-spectrum antibacterial activity. Its mode of action on L.

      • Listeria monocytogenes
      • Bacterial pathogens

  3. Intelligent Cellulose Nanofibers with Excellent Biocompatibility Enable Sustained Antibacterial and Drug Release via a pH-Responsive Mechanism

    • Journal of Agricultural and Food Chemistry

    • Novel nanosized biomass-based pH-responsive cellulose nanofibers (CNF-PEI) with excellent biocompatibility were tailored by grafting polyethylenimine (PEI) onto carboxylated cellulose nanofibers (CNF-COOH); the active site (−COOH, 0.96 mmol/g) was anchored on cellulose nanofibers (CNFs) to introduce PEI with a high density (10.57 mmol/g) of amino groups.

      • Listeria monocytogenes
      • Bacterial pathogens

  4. [ASAP] N-Glycosylation Plays an Essential and Species-Specific Role in Anti-Infection Function of Milk Proteins Using Listeria monocytogenes as Model Pathogen

    • Journal of Agricultural and Food Chemistry

    • TOC Graphic

      • Listeria monocytogenes
      • Bacterial pathogens

  5. SERS-Based Lateral Flow Strip Biosensor for Simultaneous Detection of Listeria monocytogenes and Salmonella enterica Serotype Enteritidis

    • Journal of Agricultural and Food Chemistry

    • TOC Graphic

      • Listeria monocytogenes
      • Bacterial pathogens